The x-ray structure of the cyanobacteria synechocystis hemoglobin ""cyanoglobin"" with cyanide ligand
PDB DOI: 10.2210/pdb1s69/pdb
Classification: OXYGEN STORAGE/TRANSPORT Organism(s): Synechocystis Sp.
Deposited: 2004-01-22 Deposition Author(s): Hargrove, M.S. , Hoy, J.A. , Kundu, S. , Trent Iii, J.T.
The x-ray structure of the cyanobacteria synechocystis hemoglobin ""cyanoglobin"" with cyanide ligand
Hargrove, M.S. , Hoy, J.A. , Kundu, S. , Trent Iii, J.T.
Primary Citation of Related Structures: 1S69
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cyanoglobin | A | 124 | Synechocystis Sp. | MSTLYEKLGGTTAVDLAVDKFYERVLQDDRIKHFFADVDMAKQRAHQKAFLTYAFGGTDKYDGRYMREAHKELVENHGLNGEHFDAVAEDLLATLKEMGVPEDLIAEVAAVAGAPAHKRDVLNQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2004-01-22 Deposition Author(s): Hargrove, M.S. , Hoy, J.A. , Kundu, S. , Trent Iii, J.T.