PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

1S5R

Solution structure of hbp1 sid-msin3a pah2 complex

PDB DOI: 10.2210/pdb1s5r/pdb

Classification: TRANSCRIPTION
Organism(s): Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)

Deposited: 2004-01-21
Deposition Author(s): Cowley, S.M. , Eisenman, R.N. , Huang, K. , Kang, R.S. , Knoepfler, P.S. , Laherty, C.D. , Radhakrishnan, I. , Swanson, K.A.

Experimental Data Snapshot

Method: SOLUTION NMR
Resolution: N.A.

1s5r
Literature

Solution structure of hbp1 sid-msin3a pah2 complex

Cowley, S.M. , Eisenman, R.N. , Huang, K. , Kang, R.S. , Knoepfler, P.S. , Laherty, C.D. , Radhakrishnan, I. , Swanson, K.A.

Primary Citation of Related Structures: 1S5R


Proteins
Molecule Chains Sequence Length Organism Sequence
high mobility group box transcription factor 1 A 23 Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) DFTPMDSSAVYVLSSMARQRRAS
Sin3a protein B 89 Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) SLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDA
Experimental Data

Method: SOLUTION NMR

Deposited Date: 2004-01-21
Deposition Author(s): Cowley, S.M. , Eisenman, R.N. , Huang, K. , Kang, R.S. , Knoepfler, P.S. , Laherty, C.D. , Radhakrishnan, I. , Swanson, K.A.