Crystal structure of a par-6 pdz-peptide complex
PDB DOI: 10.2210/pdb1rzx/pdb
Classification: CELL CYCLE Organism(s): Murine Hepatitis Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2003-12-29 Deposition Author(s): Penkert, R.R. , Peterson, F.C. , Prehoda, K.E. , Volkman, F.B.
Method: X-RAY DIFFRACTION Resolution: 2.1 Å
Crystal structure of a par-6 pdz-peptide complex
Penkert, R.R. , Peterson, F.C. , Prehoda, K.E. , Volkman, F.B.
Primary Citation of Related Structures: 1RZX
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
CG5884-PA | A | 98 | Murine Hepatitis Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ETHRRVRLLKHGSDKPLGFYIRDGTSVRVTASGLEKQPGIFISRLVPGGLAESTGLLAVNDEVIEVNGIEVAGKTLDQVTDMMVANSSNLIITVKPAN |
Acetylated VKESLV Peptide | B | 7 | Murine Hepatitis Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XVKESLV |
Method: X-RAY DIFFRACTION
Deposited Date: 2003-12-29 Deposition Author(s): Penkert, R.R. , Peterson, F.C. , Prehoda, K.E. , Volkman, F.B.