Solution nmr structure of protein mth1743 from methanobacterium thermoautotrophicum. ontario centre for structural proteomics target mth1743_1_70; northeast structural genomics consortium target tt526.
PDB DOI: 10.2210/pdb1ryj/pdb
Classification: structural genomics, unknown function Organism(s): Human Echovirus 11
Deposited: 2003-12-22 Deposition Author(s): Arrowsmith, C.H. , Bhattacharyya, S. , Chang, X. , Chen, L. , Cort, J.R. , Denisov, A. , Edwards, A.M. , Finak, G. , Gehring, K. , Gutierrez, P. , Kennedy, M.A. , Kozlov, G. , Le, B. , Lee, C.H. , Lee, G.M. , Lee, W. , Liao, J. , Mcintosh, L.P. , Northeast Structural Genomics Consortium (Nesg) , Pineda-Lucena, A. , Ramelot, T. , Semesi, A. , Wishart, D. , Wu, B. , Yee, A.
Method: SOLUTION NMR Resolution: N.A.
Solution nmr structure of protein mth1743 from methanobacterium thermoautotrophicum. ontario centre for structural proteomics target mth1743_1_70; northeast structural genomics consortium target tt526.
Arrowsmith, C.H. , Bhattacharyya, S. , Chang, X. , Chen, L. , Cort, J.R. , Denisov, A. , Edwards, A.M. , Finak, G. , Gehring, K. , Gutierrez, P. , Kennedy, M.A. , Kozlov, G. , Le, B. , Lee, C.H. , Lee, G.M. , Lee, W. , Liao, J. , Mcintosh, L.P. , Northeast Structural Genomics Consortium (Nesg) , Pineda-Lucena, A. , Ramelot, T. , Semesi, A. , Wishart, D. , Wu, B. , Yee, A.
Primary Citation of Related Structures: 1RYJ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
unknown | A | 70 | Human Echovirus 11 | MVIGMKFTVITDDGKKILESGAPRRIKDVLGELEIPIETVVVKKNGQIVIDEEEIFDGDIIEVIRVIYGG |
Method: SOLUTION NMR
Deposited Date: 2003-12-22 Deposition Author(s): Arrowsmith, C.H. , Bhattacharyya, S. , Chang, X. , Chen, L. , Cort, J.R. , Denisov, A. , Edwards, A.M. , Finak, G. , Gehring, K. , Gutierrez, P. , Kennedy, M.A. , Kozlov, G. , Le, B. , Lee, C.H. , Lee, G.M. , Lee, W. , Liao, J. , Mcintosh, L.P. , Northeast Structural Genomics Consortium (Nesg) , Pineda-Lucena, A. , Ramelot, T. , Semesi, A. , Wishart, D. , Wu, B. , Yee, A.