Nmr solution structure of the precursor for carnobacteriocin b2, an antimicrobial peptide from carnobacterium piscicola
PDB DOI: 10.2210/pdb1ry3/pdb
Classification: ANTIBIOTIC Organism(s): Carnobacterium Maltaromaticum
Deposited: 2003-12-19 Deposition Author(s): Gibbs, A.C. , Kawulka, K.E. , Sprules, T. , Vederas, J.C. , Wishart, D.S.
Nmr solution structure of the precursor for carnobacteriocin b2, an antimicrobial peptide from carnobacterium piscicola
Gibbs, A.C. , Kawulka, K.E. , Sprules, T. , Vederas, J.C. , Wishart, D.S.
Primary Citation of Related Structures: 1RY3
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Bacteriocin carnobacteriocin B2 | A | 64 | Carnobacterium Maltaromaticum | MNSVKELNVKEMKQLHGGVNYGNGVSCSKTKCSVNWGQAFQERYTAGINSFVSGVASGAGSIGR |
Method: SOLUTION NMR
Deposited Date: 2003-12-19 Deposition Author(s): Gibbs, A.C. , Kawulka, K.E. , Sprules, T. , Vederas, J.C. , Wishart, D.S.