Crystal structure of human caspase-1 in complex with 4-oxo-3-{6-[4-(quinoxalin-2-ylamino)-benzoylamino]-2-thiophen-2-yl-hexanoylamino}-pentanoic acid
PDB DOI: 10.2210/pdb1rwo/pdb
Classification: HYDROLASE Organism(s): Homo Sapiens
Deposited: 2003-12-16 Deposition Author(s): Fahr, B.T. , O'Brien, T. , Romanowski, M.J. , Waal, N.D.
Crystal structure of human caspase-1 in complex with 4-oxo-3-{6-[4-(quinoxalin-2-ylamino)-benzoylamino]-2-thiophen-2-yl-hexanoylamino}-pentanoic acid
Fahr, B.T. , O'Brien, T. , Romanowski, M.J. , Waal, N.D.
Primary Citation of Related Structures: 1RWO
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Interleukin-1 beta convertase | A | 178 | Homo Sapiens | NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKD |
| Interleukin-1 beta convertase | B | 88 | Homo Sapiens | AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH |
Method: X-RAY DIFFRACTION
Deposited Date: 2003-12-16 Deposition Author(s): Fahr, B.T. , O'Brien, T. , Romanowski, M.J. , Waal, N.D.