Crystal structures of a multidrug-resistant hiv-1 protease reveal an expanded active site cavity
PDB DOI: 10.2210/pdb1rq9/pdb
Classification: HYDROLASE Organism(s): Human Immunodeficiency Virus 1
Deposited: 2003-12-04 Deposition Author(s): Koepke, J.I. , Kovari, L.C. , Logsdon, B.C. , Martin, P. , Merigan, T.C. , Proteasa, G. , Terlecky, S.R. , Vickrey, J.F. , Wawrzak, Z. , Winters, M.A.
Crystal structures of a multidrug-resistant hiv-1 protease reveal an expanded active site cavity
Koepke, J.I. , Kovari, L.C. , Logsdon, B.C. , Martin, P. , Merigan, T.C. , Proteasa, G. , Terlecky, S.R. , Vickrey, J.F. , Wawrzak, Z. , Winters, M.A.
Primary Citation of Related Structures: 1RQ9
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| protease | A | 99 | Human Immunodeficiency Virus 1 | PQITLWQRPIVTIKIGGQLKEALLNTGADDTVLEEVNLPGRWKPKLIGGIGGFVKVRQYDQVPIEICGHKVIGTVLVGPTPANVIGRNLMTQIGCTLNF |
| protease | B | 99 | Human Immunodeficiency Virus 1 | PQITLWQRPIVTIKIGGQLKEALLNTGADDTVLEEVNLPGRWKPKLIGGIGGFVKVRQYDQVPIEICGHKVIGTVLVGPTPANVIGRNLMTQIGCTLNF |
Method: X-RAY DIFFRACTION
Deposited Date: 2003-12-04 Deposition Author(s): Koepke, J.I. , Kovari, L.C. , Logsdon, B.C. , Martin, P. , Merigan, T.C. , Proteasa, G. , Terlecky, S.R. , Vickrey, J.F. , Wawrzak, Z. , Winters, M.A.