1RLG
Molecular basis of box c/d rna-protein interaction: co-crystal structure of the archaeal srnp intiation complex
PDB DOI: 10.2210/pdb1rlg/pdb
Classification: Structural Protein/RNA Organism(s): Mimivirus Reunion , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2003-11-25 Deposition Author(s): Fenley, M.O. , Li, H. , Moore, T. , Zhang, Y.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.7 Å
Molecular basis of box c/d rna-protein interaction: co-crystal structure of the archaeal srnp intiation complex
Fenley, M.O. , Li, H. , Moore, T. , Zhang, Y.
Primary Citation of Related Structures: 1RLG
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 50S ribosomal protein L7Ae | A | 119 | Mimivirus Reunion , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MYVRFEVPEDMQNEALSLLEKVRESGKVKKGTNETTKAVERGLAKLVYIAEDVDPPEIVAHLPLLCEEKNVPYIYVKSKNDLGRAVGIEVPCASAAIINEGELRKELGSLVEKIKGLQK |
| 50S ribosomal protein L7Ae | B | 119 | Mimivirus Reunion , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MYVRFEVPEDMQNEALSLLEKVRESGKVKKGTNETTKAVERGLAKLVYIAEDVDPPEIVAHLPLLCEEKNVPYIYVKSKNDLGRAVGIEVPCASAAIINEGELRKELGSLVEKIKGLQK |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2003-11-25 Deposition Author(s): Fenley, M.O. , Li, H. , Moore, T. , Zhang, Y.