Structure determination of the ras-binding domain of the ral-specific guanine nucleotide exchange factor rlf, nmr, 10 structures
PDB DOI: 10.2210/pdb1rlf/pdb
Classification: SIGNAL TRANSDUCTION PROTEIN Organism(s): Mus Musculus
Deposited: 1998-07-09 Deposition Author(s): Bauer, B. , Bay, P. , Cool, R.H. , Esser, D. , Wittinghofer, A. , Wolthuis, R.M.F.
Structure determination of the ras-binding domain of the ral-specific guanine nucleotide exchange factor rlf, nmr, 10 structures
Bauer, B. , Bay, P. , Cool, R.H. , Esser, D. , Wittinghofer, A. , Wolthuis, R.M.F.
Primary Citation of Related Structures: 1RLF
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| RLF | A | 90 | Mus Musculus | GSSDCRIIRVQMELGEDGSVYKSILVTSQDKAPSVISRVLKKNNRDSAVASEFELVQLLPGDRELTIPHSANVFYAMDGASHDFLLRQRR |
Method: SOLUTION NMR
Deposited Date: 1998-07-09 Deposition Author(s): Bauer, B. , Bay, P. , Cool, R.H. , Esser, D. , Wittinghofer, A. , Wolthuis, R.M.F.