Structure of the bone morphogenetic protein 2 mutant l51p
PDB DOI: 10.2210/pdb1reu/pdb
Classification: HORMONE/GROWTH FACTOR Organism(s): Homo Sapiens
Deposited: 2003-11-07 Deposition Author(s): Keller, S. , Mueller, T.D. , Nickel, J. , Sebald, W. , Zhang, J.-L.
Structure of the bone morphogenetic protein 2 mutant l51p
Keller, S. , Mueller, T.D. , Nickel, J. , Sebald, W. , Zhang, J.-L.
Primary Citation of Related Structures: 1REU
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| bone morphogenetic protein 2 | A | 103 | Homo Sapiens | SSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPPADHLNSTNHAIVQTLVNSVNSKIPKACCVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR |
Method: X-RAY DIFFRACTION
Deposited Date: 2003-11-07 Deposition Author(s): Keller, S. , Mueller, T.D. , Nickel, J. , Sebald, W. , Zhang, J.-L.