Crystal structure of the methanococcus jannaschii l7ae protein
PDB DOI: 10.2210/pdb1ra4/pdb
Classification: STRUCTURAL PROTEIN Organism(s): Methanocaldococcus Jannaschii
Deposited: 2003-10-31 Deposition Author(s): Brown, B.A. , Maxwell, E.S. , Suryadi, J. , Tran, E.J.
Crystal structure of the methanococcus jannaschii l7ae protein
Brown, B.A. , Maxwell, E.S. , Suryadi, J. , Tran, E.J.
Primary Citation of Related Structures: 1RA4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 50S ribosomal protein L7Ae | A | 120 | Methanocaldococcus Jannaschii | GSHMAVYVKFKVPEEIQKELLDAVAKAQKIKKGANEVTKAVERGIAKLVIIAEDVKPEEVVAHLPYLCEEKGIPYAYVASKQDLGKAAGLEVAASSVAIINEGDAEELKVLIEKVNVLKQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2003-10-31 Deposition Author(s): Brown, B.A. , Maxwell, E.S. , Suryadi, J. , Tran, E.J.