Nmr structure of the membrane anchor domain (1-31) of the nonstructural protein 5a (ns5a) of hepatitis c virus (ensemble of 43 structures. sample in 100mm sds)
PDB DOI: 10.2210/pdb1r7f/pdb
Classification: MEMBRANE PROTEIN Organism(s): N.A.
Deposited: 2003-10-21 Deposition Author(s): Appel, N. , Bartenschlager, R. , Blum, H.E. , Brass, V. , Ficheux, D. , Montserret, R. , Moradpour, D. , Penin, F. , Ramboarina, S.
Method: SOLUTION NMR Resolution: N.A.
Nmr structure of the membrane anchor domain (1-31) of the nonstructural protein 5a (ns5a) of hepatitis c virus (ensemble of 43 structures. sample in 100mm sds)
Appel, N. , Bartenschlager, R. , Blum, H.E. , Brass, V. , Ficheux, D. , Montserret, R. , Moradpour, D. , Penin, F. , Ramboarina, S.
Primary Citation of Related Structures: 1R7F
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Genome polyprotein | A | 31 | N.A. | SGSWLRDIWDWICEVLSDFKTWLKAKLMPQL |
Method: SOLUTION NMR
Deposited Date: 2003-10-21 Deposition Author(s): Appel, N. , Bartenschlager, R. , Blum, H.E. , Brass, V. , Ficheux, D. , Montserret, R. , Moradpour, D. , Penin, F. , Ramboarina, S.