Solution structure of the cyclotide palicourein: implications for the development of pharmaceutical and agricultural applications
PDB DOI: 10.2210/pdb1r1f/pdb
Classification: PLANT PROTEIN Organism(s): Palicourea Condensata
Deposited: 2003-09-23 Deposition Author(s): Barry, D.G. , Bokesch, H.R. , Craik, D.J. , Daly, N.L. , Gustafson, K.R.
Solution structure of the cyclotide palicourein: implications for the development of pharmaceutical and agricultural applications
Barry, D.G. , Bokesch, H.R. , Craik, D.J. , Daly, N.L. , Gustafson, K.R.
Primary Citation of Related Structures: 1R1F
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Palicourein | A | 37 | Palicourea Condensata | TFCGETCRVIPVCTYSAALGCTCDDRSDGLCKRNGDP |
Method: SOLUTION NMR
Deposited Date: 2003-09-23 Deposition Author(s): Barry, D.G. , Bokesch, H.R. , Craik, D.J. , Daly, N.L. , Gustafson, K.R.