1R0O
Crystal structure of the heterodimeric ecdysone receptor dna-binding complex
PDB DOI: 10.2210/pdb1r0o/pdb
Classification: Transcription/DNA Organism(s): Murine Hepatitis Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2003-09-22 Deposition Author(s): Devarakonda, S. , Harp, J.M. , Kim, Y. , Ozyhar, A. , Rastinejad, F.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.24 Å
Crystal structure of the heterodimeric ecdysone receptor dna-binding complex
Devarakonda, S. , Harp, J.M. , Kim, Y. , Ozyhar, A. , Rastinejad, F.
Primary Citation of Related Structures: 1R0O
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ultraspiracle protein | A | 86 | Murine Hepatitis Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | NHPLSGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYACRENRNCIIDKRQRNRCQYCRYQKCLTCGMKREAVQEERQ |
| Ecdysone receptor | B | 109 | Murine Hepatitis Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | APRVQEELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKSAVYCCKFGRACEMDMYMRRKCQECRLKKCLAVGMRPECVVPENQCAMKRREKKAQKEKDKMTTSPSSQH |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2003-09-22 Deposition Author(s): Devarakonda, S. , Harp, J.M. , Kim, Y. , Ozyhar, A. , Rastinejad, F.