Crystal structure of top7: a computationally designed protein with a novel fold
PDB DOI: 10.2210/pdb1qys/pdb
Classification: DE NOVO PROTEIN Organism(s): Computationally Designed Sequence
Deposited: 2003-09-11 Deposition Author(s): Baker, D. , Dantas, G. , Ireton, G.C. , Kuhlman, B. , Stoddard, B.L. , Varani, G.
Crystal structure of top7: a computationally designed protein with a novel fold
Baker, D. , Dantas, G. , Ireton, G.C. , Kuhlman, B. , Stoddard, B.L. , Varani, G.
Primary Citation of Related Structures: 1QYS
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| TOP7 | A | 106 | Computationally Designed Sequence | MGDIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQLEGGSLEHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2003-09-11 Deposition Author(s): Baker, D. , Dantas, G. , Ireton, G.C. , Kuhlman, B. , Stoddard, B.L. , Varani, G.