X-ray structure of calcium-loaded calbindomodulin (a calbindin d9k re-engineered to undergo a conformational opening) at 1.44 a resolution
PDB DOI: 10.2210/pdb1qx2/pdb
Classification: SIGNALING PROTEIN Organism(s): Parengyodontium Album
Deposited: 2003-09-04 Deposition Author(s): Bunick, C.G. , Bunick, G.J. , Chazin, W.J. , Mangahas, S. , Mizoue, L.S. , Nelson, M.R.
Method: X-RAY DIFFRACTION Resolution: 1.44 Å
X-ray structure of calcium-loaded calbindomodulin (a calbindin d9k re-engineered to undergo a conformational opening) at 1.44 a resolution
Bunick, C.G. , Bunick, G.J. , Chazin, W.J. , Mangahas, S. , Mizoue, L.S. , Nelson, M.R.
Primary Citation of Related Structures: 1QX2
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Vitamin D-dependent calcium-binding protein, intestinal | A | 76 | Parengyodontium Album | MKSPEEIKGAFEVFAAKEGDPNQISKEELKLVMQTLGPSLLKGMSTLDEMIEEVDKNGDGEVSFEEFLVMMKKISQ |
Vitamin D-dependent calcium-binding protein, intestinal | B | 76 | Parengyodontium Album | MKSPEEIKGAFEVFAAKEGDPNQISKEELKLVMQTLGPSLLKGMSTLDEMIEEVDKNGDGEVSFEEFLVMMKKISQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2003-09-04 Deposition Author(s): Bunick, C.G. , Bunick, G.J. , Chazin, W.J. , Mangahas, S. , Mizoue, L.S. , Nelson, M.R.