Crystal structure of methanococcus jannaschii phosphosulfolactate synthase
PDB DOI: 10.2210/pdb1qwg/pdb
Classification: LYASE Organism(s): Methanocaldococcus Jannaschii
Deposited: 2003-09-02 Deposition Author(s): Graham, D.E. , Rayment, I. , White, R.H. , Wise, E.L.
Crystal structure of methanococcus jannaschii phosphosulfolactate synthase
Graham, D.E. , Rayment, I. , White, R.H. , Wise, E.L.
Primary Citation of Related Structures: 1QWG
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| (2R)-phospho-3-sulfolactate synthase | A | 251 | Methanocaldococcus Jannaschii | MKAFEFLYEDFQRGLTVVLDKGLPPKFVEDYLKVCGDYIDFVKFGWGTSAVIDRDVVKEKINYYKDWGIKVYPGGTLFEYAYSKGKFDEFLNECEKLGFEAVEISDGSSDISLEERNNAIKRAKDNGFMVLTEVGKKMPDKDKQLTIDDRIKLINFDLDAGADYVIIEGRESGKGKGLFDKEGKVKENELDVLAKNVDINKVIFEAPQKSQQVAFILKFGSSVNLANIAFDEVISLETLRRGLRGDTFGKV |
Method: X-RAY DIFFRACTION
Deposited Date: 2003-09-02 Deposition Author(s): Graham, D.E. , Rayment, I. , White, R.H. , Wise, E.L.