Averaged nmr model of switch arc, a double mutant of arc repressor
PDB DOI: 10.2210/pdb1qtg/pdb
Classification: GENE REGULATION Organism(s): Lederbergvirus P22
Deposited: 1999-06-27 Deposition Author(s): Cordes, M.H.J. , Mcknight, C.J. , Sauer, R.T. , Walsh, N.P.
Method: SOLUTION NMR Resolution: N.A.
Averaged nmr model of switch arc, a double mutant of arc repressor
Cordes, M.H.J. , Mcknight, C.J. , Sauer, R.T. , Walsh, N.P.
Primary Citation of Related Structures: 1QTG
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transcriptional repressor arc | A | 53 | Lederbergvirus P22 | MKGMSKMPQFLNRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRIGA |
| Transcriptional repressor arc | B | 53 | Lederbergvirus P22 | MKGMSKMPQFLNRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRIGA |
Method: SOLUTION NMR
Deposited Date: 1999-06-27 Deposition Author(s): Cordes, M.H.J. , Mcknight, C.J. , Sauer, R.T. , Walsh, N.P.