S100c (s100a11),or calgizzarin, in complex with annexin i n-terminus
PDB DOI: 10.2210/pdb1qls/pdb
Classification: METAL-BINDING PROTEIN/INHIBITOR Organism(s): Streptomyces Sviceus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 1999-09-15 Deposition Author(s): Gerke, V. , Lewit-Bentley, A. , Osterloh, D. , Renouard, M. , Rety, S. , Russo-Marie, F. , Sopkova, J.
S100c (s100a11),or calgizzarin, in complex with annexin i n-terminus
Gerke, V. , Lewit-Bentley, A. , Osterloh, D. , Renouard, M. , Rety, S. , Russo-Marie, F. , Sopkova, J.
Primary Citation of Related Structures: 1QLS
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
S100C PROTEIN | A | 99 | Streptomyces Sviceus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MAKRPTETERCIESLIAIFQKHAGRDGNNTKISKTEFLIFMNTELAAFTQNQKDPGVLDRMMKKLDLDSDGQLDFQEFLNLIGGLAIACHDSFIKSTQK |
ANNEXIN I | D | 12 | Streptomyces Sviceus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XAMVSAFLKQAW |
Method: X-RAY DIFFRACTION
Deposited Date: 1999-09-15 Deposition Author(s): Gerke, V. , Lewit-Bentley, A. , Osterloh, D. , Renouard, M. , Rety, S. , Russo-Marie, F. , Sopkova, J.