Unexpected modes of pdz domain scaffolding revealed by structure of nnos-syntrophin complex
PDB DOI: 10.2210/pdb1qau/pdb
Classification: OXIDOREDUCTASE Organism(s): Rattus Norvegicus
Deposited: 1999-03-29 Deposition Author(s): Bredt, D.S. , Christopherson, K.S. , Hillier, B.J. , Lim, W.A. , Prehoda, K.E.
Unexpected modes of pdz domain scaffolding revealed by structure of nnos-syntrophin complex
Bredt, D.S. , Christopherson, K.S. , Hillier, B.J. , Lim, W.A. , Prehoda, K.E.
Primary Citation of Related Structures: 1QAU
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| NEURONAL NITRIC OXIDE SYNTHASE (RESIDUES 1-130) | A | 112 | Rattus Norvegicus | NVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTIRVTQP |
Method: X-RAY DIFFRACTION
Deposited Date: 1999-03-29 Deposition Author(s): Bredt, D.S. , Christopherson, K.S. , Hillier, B.J. , Lim, W.A. , Prehoda, K.E.