Solution structure of tandem uims of vps27
PDB DOI: 10.2210/pdb1q0v/pdb
Classification: TRANSPORT BINDING Organism(s): Grouper Iridovirus
Deposited: 2003-07-17 Deposition Author(s): Hicke, L. , Kang, R.S. , Radhakrishnan, I. , Stamenova, S.D. , Swanson, K.A.
Solution structure of tandem uims of vps27
Hicke, L. , Kang, R.S. , Radhakrishnan, I. , Stamenova, S.D. , Swanson, K.A.
Primary Citation of Related Structures: 1Q0V
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
hydrophilic protein; has cysteine rich putative zinc finger essential for function; Vps27p | A | 81 | Grouper Iridovirus | MDRDYSTPEDEEELIRKAIELSLKESRNSASSEPIVPVVESKNEVKRQEIEEEEDPDLKAAIQESLREAEEAKLRSERQKA |
Method: SOLUTION NMR
Deposited Date: 2003-07-17 Deposition Author(s): Hicke, L. , Kang, R.S. , Radhakrishnan, I. , Stamenova, S.D. , Swanson, K.A.