Structure of fused docking domains from the erythromycin polyketide synthase (debs), a model for the interaction between debs 2 and debs 3: the a domain
PDB DOI: 10.2210/pdb1pzq/pdb
Classification: TRANSFERASE Organism(s): Saccharopolyspora Erythraea
Deposited: 2003-07-14 Deposition Author(s): Broadhurst, R.W. , Leadlay, P.F. , Nietlispach, D. , Weissman, K.J. , Wheatcroft, M.P.
Method: SOLUTION NMR Resolution: N.A.
Structure of fused docking domains from the erythromycin polyketide synthase (debs), a model for the interaction between debs 2 and debs 3: the a domain
Broadhurst, R.W. , Leadlay, P.F. , Nietlispach, D. , Weissman, K.J. , Wheatcroft, M.P.
Primary Citation of Related Structures: 1PZQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Erythronolide synthase | A | 60 | Saccharopolyspora Erythraea | GSAASPAVDIGDRLDELEKALEALSAEDGHDDVGQRLESLLRRWNSRRADAPSTSAISED |
| Erythronolide synthase | B | 60 | Saccharopolyspora Erythraea | GSAASPAVDIGDRLDELEKALEALSAEDGHDDVGQRLESLLRRWNSRRADAPSTSAISED |
Method: SOLUTION NMR
Deposited Date: 2003-07-14 Deposition Author(s): Broadhurst, R.W. , Leadlay, P.F. , Nietlispach, D. , Weissman, K.J. , Wheatcroft, M.P.