1PYV
Nmr solution structure of the mitochondrial f1b presequence peptide from nicotiana plumbaginifolia
PDB DOI: 10.2210/pdb1pyv/pdb
Classification: HYDROLASE Organism(s): Nicotiana Plumbaginifolia
Deposited: 2003-07-09 Deposition Author(s): Eriksson, A.C. , Glaser, E. , Maler, L. , Moberg, P. , Nilsson, S. , Stahl, A.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Nmr solution structure of the mitochondrial f1b presequence peptide from nicotiana plumbaginifolia
Eriksson, A.C. , Glaser, E. , Maler, L. , Moberg, P. , Nilsson, S. , Stahl, A.
Primary Citation of Related Structures: 1PYV
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| ATP synthase beta chain, mitochondrial precursor | A | 54 | Nicotiana Plumbaginifolia | MASRRLLASLLRQSAQRGGGLISRSLGNSIPKSASRASSRASPKGFLLNRAVQY |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2003-07-09 Deposition Author(s): Eriksson, A.C. , Glaser, E. , Maler, L. , Moberg, P. , Nilsson, S. , Stahl, A.