The crystal structure of an autoantigen in multiple sclerosis
PDB DOI: 10.2210/pdb1py9/pdb
Classification: IMMUNE SYSTEM Organism(s): Mus Musculus
Deposited: 2003-07-08 Deposition Author(s): Beddoe, T. , Bernard, C.C. , Clements, C.S. , Johns, T.G. , Perugini, M.A. , Reid, H.H. , Rossjohn, J. , Tynan, F.E.
The crystal structure of an autoantigen in multiple sclerosis
Beddoe, T. , Bernard, C.C. , Clements, C.S. , Johns, T.G. , Perugini, M.A. , Reid, H.H. , Rossjohn, J. , Tynan, F.E.
Primary Citation of Related Structures: 1PY9
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Myelin-oligodendrocyte glycoprotein | A | 116 | Mus Musculus | QFRVIGPGYPIRALVGDEAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKETISEGKVTLRIQNVRFSDEGGYTCFFRDHSYQEEAAMELKVED |
Method: X-RAY DIFFRACTION
Deposited Date: 2003-07-08 Deposition Author(s): Beddoe, T. , Bernard, C.C. , Clements, C.S. , Johns, T.G. , Perugini, M.A. , Reid, H.H. , Rossjohn, J. , Tynan, F.E.