Solution structure of a cchhc domain of neural zinc finger factor-1
PDB DOI: 10.2210/pdb1pxe/pdb
Classification: METAL BINDING PROTEIN Organism(s): Rattus Norvegicus
Deposited: 2003-07-03 Deposition Author(s): Amann, B.T. , Berg, J.M. , Berkovits-Cymet, H.J.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of a cchhc domain of neural zinc finger factor-1
Amann, B.T. , Berg, J.M. , Berkovits-Cymet, H.J.
Primary Citation of Related Structures: 1PXE
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| neural zinc finger transcription factor 1 | A | 63 | Rattus Norvegicus | MHVKKPYYDPSRTEKRESKCPTPGCDGTGHVTGLYPHHRSLSGCPHKDRVPPEILAMHENVLK |
Method: SOLUTION NMR
Deposited Date: 2003-07-03 Deposition Author(s): Amann, B.T. , Berg, J.M. , Berkovits-Cymet, H.J.