Structure of the sda antikinase
PDB DOI: 10.2210/pdb1pv0/pdb
Classification: SIGNALING PROTEIN Organism(s): Tomato Spotted Wilt Virus (Strain Bulgarian L3)
Deposited: 2003-06-26 Deposition Author(s): Burkholder, W.F. , Grossman, A.D. , King, G.F. , Maciejewski, M.W. , Rowland, S.L.
Structure of the sda antikinase
Burkholder, W.F. , Grossman, A.D. , King, G.F. , Maciejewski, M.W. , Rowland, S.L.
Primary Citation of Related Structures: 1PV0
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Sda | A | 46 | Tomato Spotted Wilt Virus (Strain Bulgarian L3) | MRKLSDELLIESYFKATEMNLNRDFIELIENEIKRRSLGHIISVSS |
Method: SOLUTION NMR
Deposited Date: 2003-06-26 Deposition Author(s): Burkholder, W.F. , Grossman, A.D. , King, G.F. , Maciejewski, M.W. , Rowland, S.L.