Coordinates of s12, l11 proteins and e-site trna from 70s crystal structure separately fitted into the cryo-em map of e.coli 70s.ef-g.gdpnp complex. the atomic coordinates originally from the e-site trna were fitted in the position of the hybrid p/e-site trna.
PDB DOI: 10.2210/pdb1pn8/pdb
Classification: RNA binding protein/RNA Organism(s): Panax Ginseng , Scytalidium Thermophilum , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2003-06-12 Deposition Author(s): Ehrenberg, M. , Frank, J. , Rawat, U. , Sengupta, J. , Valle, M. , Zavialov, A.
Coordinates of s12, l11 proteins and e-site trna from 70s crystal structure separately fitted into the cryo-em map of e.coli 70s.ef-g.gdpnp complex. the atomic coordinates originally from the e-site trna were fitted in the position of the hybrid p/e-site trna.
Ehrenberg, M. , Frank, J. , Rawat, U. , Sengupta, J. , Valle, M. , Zavialov, A.
Primary Citation of Related Structures: 1PN8
Nucleic Acids / Hybrid | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
E-tRNA | d | 68 | NA | UCCGUGAAACAAAGCGGAUGUACCGGAUUUUUAUUCCGGCUAUGGGGCAAUUCCCCGUCGCGGAGCCA |
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
30S ribosomal protein S12 | O | 124 | Panax Ginseng , Scytalidium Thermophilum , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA |
50S ribosomal protein L11 | L | 133 | Panax Ginseng , Scytalidium Thermophilum , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | QIKLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETADKAGMILPVVITVYEDKSFTFIIKTPPASFLLKKAAGIEKGSSEPKRKIVGKVTRKQIEEIAKTKMPDLNANSLEAAMKIIEGTAKSMGIEVV |
Method: ELECTRON MICROSCOPY
Deposited Date: 2003-06-12 Deposition Author(s): Ehrenberg, M. , Frank, J. , Rawat, U. , Sengupta, J. , Valle, M. , Zavialov, A.