Structural basis for specific binding of polycomb chromodomain to histone h3 methylated at k27
PDB DOI: 10.2210/pdb1pfb/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Drosophila Melanogaster , Synthetic Construct
Deposited: 2003-05-24 Deposition Author(s): Min, J.R. , Xu, R.-M. , Zhang, Y.
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Polycomb protein | A | 55 | Drosophila Melanogaster , Synthetic Construct | DLVYAAEKIIQKRVKKGVVEYRVKWKGWNQRYNTWEPEVNILDRRLIDIYEQTNK |
Histone H3, embryonic | B | 11 | Drosophila Melanogaster , Synthetic Construct | LATKAARKSAP |
Method: X-RAY DIFFRACTION