1PDQ
Polycomb chromodomain complexed with the histone h3 tail containing trimethyllysine 27.
PDB DOI: 10.2210/pdb1pdq/pdb
Classification: STRUCTURAL PROTEIN Organism(s): Murine Hepatitis Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2003-05-20 Deposition Author(s): Allis, C.D. , Fischle, W. , Jacobs, S.A. , Khorasanizadeh, S. , Kim, Y. , Wang, Y.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.76 Å
Polycomb chromodomain complexed with the histone h3 tail containing trimethyllysine 27.
Allis, C.D. , Fischle, W. , Jacobs, S.A. , Khorasanizadeh, S. , Kim, Y. , Wang, Y.
Primary Citation of Related Structures: 1PDQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Polycomb protein | A | 72 | Murine Hepatitis Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MKKHHHHHHDNATDDPVDLVYAAEKIIQKRVKKGVVEYRVKWKGWNQRYNTWEPEVNILDRRLIDIYEQTNK |
| Histone H3.3 | B | 18 | Murine Hepatitis Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | APRKQLATKAARKSAPST |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2003-05-20 Deposition Author(s): Allis, C.D. , Fischle, W. , Jacobs, S.A. , Khorasanizadeh, S. , Kim, Y. , Wang, Y.