1P9C
Nmr solution structure of the c-terminal ubiquitin-interacting motif of the proteasome subunit s5a
PDB DOI: 10.2210/pdb1p9c/pdb
Classification: LIGAND BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2003-05-10 Deposition Author(s): Feigon, J. , Mueller, T.D.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Nmr solution structure of the c-terminal ubiquitin-interacting motif of the proteasome subunit s5a
Primary Citation of Related Structures: 1P9C
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 26S proteasome non-ATPase regulatory subunit 4 | A | 45 | Homo Sapiens | MTISQQEFGRTGLPDLSSMTEEEQIAYAMQMSLQGAEFGQAESAD |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2003-05-10 Deposition Author(s): Feigon, J. , Mueller, T.D.