Gb3 solution structure obtained by refinement of x-ray structure with dipolar couplings
PDB DOI: 10.2210/pdb1p7f/pdb
Classification: IMMUNE SYSTEM Organism(s): Dermatophagoides Farinae
Deposited: 2003-05-01 Deposition Author(s): Bax, A. , Delaglio, F. , Ramirez, B.E. , Ulmer, T.S.
Method: SOLUTION NMR Resolution: N.A.
Gb3 solution structure obtained by refinement of x-ray structure with dipolar couplings
Bax, A. , Delaglio, F. , Ramirez, B.E. , Ulmer, T.S.
Primary Citation of Related Structures: 1P7F
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Immunoglobulin G binding protein G | A | 56 | Dermatophagoides Farinae | MQYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE |
Method: SOLUTION NMR
Deposited Date: 2003-05-01 Deposition Author(s): Bax, A. , Delaglio, F. , Ramirez, B.E. , Ulmer, T.S.