Solution structure of the third zinc finger from bklf
PDB DOI: 10.2210/pdb1p7a/pdb
Classification: DNA BINDING PROTEIN Organism(s): Enterobacter Aerogenes
Deposited: 2003-04-30 Deposition Author(s): Cram, E.D. , Crossley, M. , Czolij, R. , Mackay, J.P. , Matthews, J.M. , Simpson, R.J.Y.
Solution structure of the third zinc finger from bklf
Cram, E.D. , Crossley, M. , Czolij, R. , Mackay, J.P. , Matthews, J.M. , Simpson, R.J.Y.
Primary Citation of Related Structures: 1P7A
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Kruppel-like factor 3 | A | 37 | Enterobacter Aerogenes | GSTRGSTGIKPFQCPDCDRSFSRSDHLALHRKRHMLV |
Method: SOLUTION NMR
Deposited Date: 2003-04-30 Deposition Author(s): Cram, E.D. , Crossley, M. , Czolij, R. , Mackay, J.P. , Matthews, J.M. , Simpson, R.J.Y.