Advanced Search:
1P65
Crystal structure of the nucleocapsid protein of porcine reproductive and respiratory syndrome virus (prrsv)
PDB DOI: 10.2210/pdb1p65/pdb
Classification: VIRAL PROTEIN Organism(s): Porcine Respiratory And Reproductive Syndrome Virus
Deposited: 2003-04-29 Deposition Author(s): Doan, D.N.P. , Dokland, T.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.6 Å
Crystal structure of the nucleocapsid protein of porcine reproductive and respiratory syndrome virus (prrsv)
Primary Citation of Related Structures: 1P65
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| nucleocapsid protein | A | 73 | Porcine Respiratory And Reproductive Syndrome Virus | MAHHHHHHTEDDVRHHFTPSERQLCLSSIQTAFNQGAGTCTLSDSGRISYTVEFSLPTHHTVRLIRVTASPSA |
| nucleocapsid protein | B | 73 | Porcine Respiratory And Reproductive Syndrome Virus | MAHHHHHHTEDDVRHHFTPSERQLCLSSIQTAFNQGAGTCTLSDSGRISYTVEFSLPTHHTVRLIRVTASPSA |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2003-04-29 Deposition Author(s): Doan, D.N.P. , Dokland, T.