Crystal structure of tandem zif268 molecules complexed to dna
PDB DOI: 10.2210/pdb1p47/pdb
Classification: Transcription/DNA Organism(s): Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2003-04-21 Deposition Author(s): Pabo, C.O. , Peisach, E.
Crystal structure of tandem zif268 molecules complexed to dna
Primary Citation of Related Structures: 1P47
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Early growth response protein 1 | A | 87 | Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQ |
Early growth response protein 1 | B | 87 | Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2003-04-21 Deposition Author(s): Pabo, C.O. , Peisach, E.