Crystal structure of the src sh2 domain complexed with peptide (sdpyanfk)
PDB DOI: 10.2210/pdb1p13/pdb
Classification: TRANSFERASE Organism(s): Caldanaerobius , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2003-04-11 Deposition Author(s): Bilwes, A. , Hunter, T. , Noel, J.P. , Sonnenburg, E.D.
Crystal structure of the src sh2 domain complexed with peptide (sdpyanfk)
Bilwes, A. , Hunter, T. , Noel, J.P. , Sonnenburg, E.D.
Primary Citation of Related Structures: 1P13
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Proto-oncogene tyrosine-protein kinase Src | A | 102 | Caldanaerobius , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | AEEWYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHRLTNVCP |
Proto-oncogene tyrosine-protein kinase Src | B | 102 | Caldanaerobius , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | AEEWYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHRLTNVCP |
Peptide | C | 7 | Caldanaerobius , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | CDYANFK |
Peptide | D | 7 | Caldanaerobius , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | CDYANFK |
Method: X-RAY DIFFRACTION
Deposited Date: 2003-04-11 Deposition Author(s): Bilwes, A. , Hunter, T. , Noel, J.P. , Sonnenburg, E.D.