Nmr structure of etd151, mutant of the antifungal defensin ard1 from archaeoprepona demophon
PDB DOI: 10.2210/pdb1p00/pdb
Classification: ANTIFUNGAL PROTEIN Organism(s): Archaeoprepona Demophon
Deposited: 2003-04-10 Deposition Author(s): Barbault, F. , Dimarcq, J.L. , Guenneugues, M. , Landon, C. , Legrain, M. , Menin, L. , Schott, V. , Vovelle, F.
Nmr structure of etd151, mutant of the antifungal defensin ard1 from archaeoprepona demophon
Barbault, F. , Dimarcq, J.L. , Guenneugues, M. , Landon, C. , Legrain, M. , Menin, L. , Schott, V. , Vovelle, F.
Primary Citation of Related Structures: 1P00
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| defensin ARD1 | A | 44 | Archaeoprepona Demophon | DKLIGSCVWGAVNYTSNCRAECKRRGYKGGHCGSFANVNCWCET |
Method: SOLUTION NMR
Deposited Date: 2003-04-10 Deposition Author(s): Barbault, F. , Dimarcq, J.L. , Guenneugues, M. , Landon, C. , Legrain, M. , Menin, L. , Schott, V. , Vovelle, F.