Crystal structure of a mutant ihf (betae44a) complexed with the native h' site
PDB DOI: 10.2210/pdb1owf/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Escherichia Coli , Synthetic Construct
Deposited: 2003-03-28 Deposition Author(s): Gardner, J.F. , Lynch, T.W. , Mattis, A.N. , Read, E.K. , Rice, P.A.
Crystal structure of a mutant ihf (betae44a) complexed with the native h' site
Gardner, J.F. , Lynch, T.W. , Mattis, A.N. , Read, E.K. , Rice, P.A.
Primary Citation of Related Structures: 1OWF
| Nucleic Acids / Hybrid | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Phage lambda H' site | c | 35 | NA | CGGTGCAACAAATTGATAAGCAATGCTTTTTTGGC |
| 5'-D(*GP*GP*CP*CP*AP*AP*AP*AP*AP*AP*GP*CP*AP*TP*T)-3' | d | 15 | NA | GGCCAAAAAAGCATT |
| 5'-D(*GP*CP*TP*TP*AP*TP*CP*AP*AP*TP*TP*TP*GP*TP*TP*GP*CP*AP*CP*C)-3' | e | 20 | NA | GCTTATCAATTTGTTGCACC |
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Integration Host Factor Alpha-subunit | A | 99 | Escherichia Coli , Synthetic Construct | MALTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIPITARRVVTFRPGQKLKSRVENASPKDE |
| Integration Host Factor beta-subunit | B | 94 | Escherichia Coli , Synthetic Construct | MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIAIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG |
Method: X-RAY DIFFRACTION
Deposited Date: 2003-03-28 Deposition Author(s): Gardner, J.F. , Lynch, T.W. , Mattis, A.N. , Read, E.K. , Rice, P.A.