Solution structure of the extracellular domain of blys receptor 3 (br3)
PDB DOI: 10.2210/pdb1osx/pdb
Classification: IMMUNE SYSTEM Organism(s): Homo Sapiens
Deposited: 2003-03-20 Deposition Author(s): Cochran, A.G. , Dixit, V.M. , Fairbrother, W.J. , Gordon, N.C. , Hymowitz, S.G. , Kelley, R.F. , Pan, B. , Starovasnik, M.A. , Yan, M. , Yin, J.P.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the extracellular domain of blys receptor 3 (br3)
Cochran, A.G. , Dixit, V.M. , Fairbrother, W.J. , Gordon, N.C. , Hymowitz, S.G. , Kelley, R.F. , Pan, B. , Starovasnik, M.A. , Yan, M. , Yin, J.P.
Primary Citation of Related Structures: 1OSX
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Tumor necrosis factor receptor superfamily member 13C | A | 61 | Homo Sapiens | MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQE |
Method: SOLUTION NMR
Deposited Date: 2003-03-20 Deposition Author(s): Cochran, A.G. , Dixit, V.M. , Fairbrother, W.J. , Gordon, N.C. , Hymowitz, S.G. , Kelley, R.F. , Pan, B. , Starovasnik, M.A. , Yan, M. , Yin, J.P.