Solution structure of the brct-c domain from human brca1
PDB DOI: 10.2210/pdb1oqa/pdb
Classification: GENE REGULATION Organism(s): Homo Sapiens
Deposited: 2003-03-07 Deposition Author(s): Ball, L.J. , Gaiser, O.J. , Heinemann, U. , Kuhne, R. , Leitner, D. , Oschkinat, H. , Schmieder, P. , Strauss, H. , Wahl, M.
Solution structure of the brct-c domain from human brca1
Ball, L.J. , Gaiser, O.J. , Heinemann, U. , Kuhne, R. , Leitner, D. , Oschkinat, H. , Schmieder, P. , Strauss, H. , Wahl, M.
Primary Citation of Related Structures: 1OQA
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Breast cancer type 1 susceptibility protein | A | 110 | Homo Sapiens | GSQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDAWTEDNGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIPHSHY |
Method: SOLUTION NMR
Deposited Date: 2003-03-07 Deposition Author(s): Ball, L.J. , Gaiser, O.J. , Heinemann, U. , Kuhne, R. , Leitner, D. , Oschkinat, H. , Schmieder, P. , Strauss, H. , Wahl, M.