A core mutation affecting the folding properties of a soluble domain of the atpase protein copa from bacillus subtilis
PDB DOI: 10.2210/pdb1oq3/pdb
Classification: HYDROLASE Organism(s): Tomato Spotted Wilt Virus (Strain Bulgarian L3)
Deposited: 2003-03-07 Deposition Author(s): Banci, L. , Bertini, I. , Ciofi-Baffoni, S. , Gonnelli, L. , Structural Proteomics In Europe (Spine) , Su, X.C.
Method: SOLUTION NMR Resolution: N.A.
A core mutation affecting the folding properties of a soluble domain of the atpase protein copa from bacillus subtilis
Banci, L. , Bertini, I. , Ciofi-Baffoni, S. , Gonnelli, L. , Structural Proteomics In Europe (Spine) , Su, X.C.
Primary Citation of Related Structures: 1OQ3
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Potential copper-transporting ATPase | A | 76 | Tomato Spotted Wilt Virus (Strain Bulgarian L3) | MLSEQKEIAMQVSGMTCAACAARIEKGLKRMPGVTDANVNLATETVNVIYDPAETGTAAIQEKIEKLGYHVVIEGR |
Method: SOLUTION NMR
Deposited Date: 2003-03-07 Deposition Author(s): Banci, L. , Bertini, I. , Ciofi-Baffoni, S. , Gonnelli, L. , Structural Proteomics In Europe (Spine) , Su, X.C.