Solution nmr structure of domain 1 of receptor associated protein
PDB DOI: 10.2210/pdb1op1/pdb
Classification: Receptor Associated Protein Organism(s): Homo Sapiens
Deposited: 2003-03-04 Deposition Author(s): Migliorini, M. , Strickland, D.K. , Wang, Y.-X. , Wu, Y. , Yu, P.
Solution nmr structure of domain 1 of receptor associated protein
Migliorini, M. , Strickland, D.K. , Wang, Y.-X. , Wu, Y. , Yu, P.
Primary Citation of Related Structures: 1OP1
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Alpha-2-macroglobulin receptor-associated protein precursor | A | 82 | Homo Sapiens | GEEFRMEKLNQLWEKAQRLHLPPVRLAELHADLKIQERDELAWKKLKLDGLDEDGEKEARLIRNLNVILAKYGLDGKKDARQ |
Method: SOLUTION NMR
Deposited Date: 2003-03-04 Deposition Author(s): Migliorini, M. , Strickland, D.K. , Wang, Y.-X. , Wu, Y. , Yu, P.