Crystal structure of lush from drosophila melanogaster at ph 6.5
PDB DOI: 10.2210/pdb1ooi/pdb
Classification: TRANSPORT PROTEIN Organism(s): Drosophila Melanogaster
Deposited: 2003-03-03 Deposition Author(s): Jones, D.N.M. , Kruse, S.W. , Smith, D.P. , Zhao, R.
Method: X-RAY DIFFRACTION Resolution: 2.04 Å
Crystal structure of lush from drosophila melanogaster at ph 6.5
Jones, D.N.M. , Kruse, S.W. , Smith, D.P. , Zhao, R.
Primary Citation of Related Structures: 1OOI
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| odorant binding protein LUSH | X | 124 | Drosophila Melanogaster | MTMEQFLTSLDMIRSGCAPKFKLKTEDLDRLRVGDFNFPPSQDLMCYTKCVSLMAGTVNKKGEFNAPKALAQLPHLVPPEMMEMSRKSVEACRDTHKQFKESCERVYQTAKCFSENADGQFMWP |
Method: X-RAY DIFFRACTION
Deposited Date: 2003-03-03 Deposition Author(s): Jones, D.N.M. , Kruse, S.W. , Smith, D.P. , Zhao, R.