Crystal structure of the nco-a1 pas-b domain bound to the stat6 transactivation domain lxxll motif
PDB DOI: 10.2210/pdb1oj5/pdb
Classification: TRANSCRIPTIONAL COACTIVATOR Organism(s): Mus Musculus , Synthetic Construct
Deposited: 2003-07-02 Deposition Author(s): Becker, S. , Carlomagno, T. , Giller, K. , Griesinger, C. , Lakomek, N. , Litterst, C.M. , Lodrini, M. , Pftizner, E. , Ramakrishnan, V. , Razeto, A.
Crystal structure of the nco-a1 pas-b domain bound to the stat6 transactivation domain lxxll motif
Becker, S. , Carlomagno, T. , Giller, K. , Griesinger, C. , Lakomek, N. , Litterst, C.M. , Lodrini, M. , Pftizner, E. , Ramakrishnan, V. , Razeto, A.
Primary Citation of Related Structures: 1OJ5
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| STEROID RECEPTOR COACTIVATOR 1A | A | 132 | Mus Musculus , Synthetic Construct | GHMTGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFFQPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTRCKLCYPQSPDMQPFIMGIHIIDREHSGLSPQDDTNSGMSIPR |
| SIGNAL TRANSDUCER AND ACTIVATOR OF TRANSCRIPTION 6 | B | 14 | Mus Musculus , Synthetic Construct | LPPTEQDLTKLLLE |
Method: X-RAY DIFFRACTION
Deposited Date: 2003-07-02 Deposition Author(s): Becker, S. , Carlomagno, T. , Giller, K. , Griesinger, C. , Lakomek, N. , Litterst, C.M. , Lodrini, M. , Pftizner, E. , Ramakrishnan, V. , Razeto, A.