Solution structure of the prp40 ww domain pair of the yeast splicing factor prp40
PDB DOI: 10.2210/pdb1o6w/pdb
Classification: NUCLEAR PROTEIN Organism(s): Saccharomyces Cerevisiae
Deposited: 2002-10-16 Deposition Author(s): Macias, M.J. , Sattler, M. , Stier, G. , Wiesner, S.
Solution structure of the prp40 ww domain pair of the yeast splicing factor prp40
Macias, M.J. , Sattler, M. , Stier, G. , Wiesner, S.
Primary Citation of Related Structures: 1O6W
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PRE-MRNA PROCESSING PROTEIN PRP40 | A | 75 | Saccharomyces Cerevisiae | MSIWKEAKDASGRIYYYNTLTKKSTWEKPKELISQEELLLRENGWKAAKTADGKVYYYNPTTRETSWTIPAFEKK |
Method: SOLUTION NMR
Deposited Date: 2002-10-16 Deposition Author(s): Macias, M.J. , Sattler, M. , Stier, G. , Wiesner, S.