Ternary complex of the dna binding domains of the oct1 and sox2 transcription factors with a 19mer oligonucleotide from the hoxb1 regulatory element
PDB DOI: 10.2210/pdb1o4x/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2003-07-17 Deposition Author(s): Clore, G.M. , Williams, D.C.
Method: SOLUTION NMR Resolution: N.A.
Ternary complex of the dna binding domains of the oct1 and sox2 transcription factors with a 19mer oligonucleotide from the hoxb1 regulatory element
Primary Citation of Related Structures: 1O4X
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| transcription factor Oct-1 | A | 167 | Homo Sapiens , Synthetic Construct | GSHMEEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMAKLKPLLEKWLNDAENLSSDSSLSSPSALNSPGIEGLSERRKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRVWFCNRRQKEKRINPPSS |
| Transcription factor SOX-2 | B | 88 | Homo Sapiens , Synthetic Construct | GSHMPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMK |
Method: SOLUTION NMR
Deposited Date: 2003-07-17 Deposition Author(s): Clore, G.M. , Williams, D.C.