Crystal structure of src sh2 domain bound to doubly phosphorylated peptide pqpyipyvpa
PDB DOI: 10.2210/pdb1nzv/pdb
Classification: TRANSFERASE Organism(s): Rous Sarcoma Virus (Strain Schmidt-Ruppin) , Synthetic Construct
Deposited: 2003-02-19 Deposition Author(s): Lubman, O.Y. , Waksman, G.
Method: X-RAY DIFFRACTION Resolution: 2.1 Å
Crystal structure of src sh2 domain bound to doubly phosphorylated peptide pqpyipyvpa
Primary Citation of Related Structures: 1NZV
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Tyrosine-protein kinase transforming protein SRC | A | 103 | Rous Sarcoma Virus (Strain Schmidt-Ruppin) , Synthetic Construct | AEEWYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHRLTNVCPT |
| Tyrosine-protein kinase transforming protein SRC | B | 103 | Rous Sarcoma Virus (Strain Schmidt-Ruppin) , Synthetic Construct | AEEWYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHRLTNVCPT |
| Doubly phosphorylated peptide PQpYIpYVPA | C | 8 | Rous Sarcoma Virus (Strain Schmidt-Ruppin) , Synthetic Construct | PQYIYVPA |
Method: X-RAY DIFFRACTION
Deposited Date: 2003-02-19 Deposition Author(s): Lubman, O.Y. , Waksman, G.