The horse heart myoglobin variant k45e/k63e complexed with cadmium
PDB DOI: 10.2210/pdb1nz4/pdb
Classification: OXYGEN STORAGE/TRANSPORT Organism(s): Equus Caballus
Deposited: 2003-02-15 Deposition Author(s): Brayer, G.D. , Hunter, C.L. , Lee, H. , Mauk, A.G. , Mauk, M.R. , Maurus, R. , Nguyen, N. , Raven, E.L. , Smith, S. , Tong, H.
Method: X-RAY DIFFRACTION Resolution: 1.8 Å
The horse heart myoglobin variant k45e/k63e complexed with cadmium
Brayer, G.D. , Hunter, C.L. , Lee, H. , Mauk, A.G. , Mauk, M.R. , Maurus, R. , Nguyen, N. , Raven, E.L. , Smith, S. , Tong, H.
Primary Citation of Related Structures: 1NZ4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Myoglobin | A | 153 | Equus Caballus | GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDEFKHLKTEAEMKASEDLKEHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHPGDFGADAQGAMTKALELFRNDIAAKYKELGFQG |
Method: X-RAY DIFFRACTION
Deposited Date: 2003-02-15 Deposition Author(s): Brayer, G.D. , Hunter, C.L. , Lee, H. , Mauk, A.G. , Mauk, M.R. , Maurus, R. , Nguyen, N. , Raven, E.L. , Smith, S. , Tong, H.