The high resolution structures of rmlc from streptoccus suis in complex with dtdp-d-glucose
PDB DOI: 10.2210/pdb1nyw/pdb
Classification: ISOMERASE Organism(s): Streptococcus Suis
Deposited: 2003-02-14 Deposition Author(s): Allen, A. , Blankenfeldt, W. , Dong, C. , Major, L.L. , Maskell, D. , Naismith, J.H.
The high resolution structures of rmlc from streptoccus suis in complex with dtdp-d-glucose
Allen, A. , Blankenfeldt, W. , Dong, C. , Major, L.L. , Maskell, D. , Naismith, J.H.
Primary Citation of Related Structures: 1NYW
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase | A | 197 | Streptococcus Suis | MTENFFGKTLAARPVEAIPGMLEFDIPVHGDNRGWFKENFQKEKMLPLGFPESFFAEGKLQNNVSFSRKNVLRGLHAEPWDKYISVADGGKVLGTWVDLREGETFGNTYQTVIDASKSIFVPRGVANGFQVLSDFVAYSYLVNDYWALELKPKYAFVNYADPSLDIKWENLEEAEVSEADENHPFLKDVKPLRKEDL |
| dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase | B | 197 | Streptococcus Suis | MTENFFGKTLAARPVEAIPGMLEFDIPVHGDNRGWFKENFQKEKMLPLGFPESFFAEGKLQNNVSFSRKNVLRGLHAEPWDKYISVADGGKVLGTWVDLREGETFGNTYQTVIDASKSIFVPRGVANGFQVLSDFVAYSYLVNDYWALELKPKYAFVNYADPSLDIKWENLEEAEVSEADENHPFLKDVKPLRKEDL |
Method: X-RAY DIFFRACTION
Deposited Date: 2003-02-14 Deposition Author(s): Allen, A. , Blankenfeldt, W. , Dong, C. , Major, L.L. , Maskell, D. , Naismith, J.H.