Crystal structure of the murine disabled-1 (dab1) ptb domain-apoer2 peptide-pi-4,5p2 ternary complex
PDB DOI: 10.2210/pdb1nu2/pdb
Classification: SIGNALING PROTEIN Organism(s): Mus Musculus , Synthetic Construct
Deposited: 2003-01-30 Deposition Author(s): Blacklow, S.C. , Eck, M.J. , Herz, J. , Jeon, H. , Song, H.K. , Stolt, P.C.
Method: X-RAY DIFFRACTION Resolution: 1.9 Å
Crystal structure of the murine disabled-1 (dab1) ptb domain-apoer2 peptide-pi-4,5p2 ternary complex
Blacklow, S.C. , Eck, M.J. , Herz, J. , Jeon, H. , Song, H.K. , Stolt, P.C.
Primary Citation of Related Structures: 1NU2
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Disabled homolog 1 | A | 152 | Mus Musculus , Synthetic Construct | GQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKA |
| peptide derived from murine Apolipoprotein E Receptor-2 | B | 10 | Mus Musculus , Synthetic Construct | NFDNPVYRKT |
Method: X-RAY DIFFRACTION
Deposited Date: 2003-01-30 Deposition Author(s): Blacklow, S.C. , Eck, M.J. , Herz, J. , Jeon, H. , Song, H.K. , Stolt, P.C.