Solution structure of the n-terminal receiver domain of ntrc
PDB DOI: 10.2210/pdb1ntr/pdb
Classification: GENE REGULATORY PROTEIN Organism(s): Salmonella Typhimurium
Deposited: 1994-09-16 Deposition Author(s): Amy, N.K. , Kustu, S. , Nohaile, M.J. , Volkman, B.F. , Wemmer, D.E.
Solution structure of the n-terminal receiver domain of ntrc
Amy, N.K. , Kustu, S. , Nohaile, M.J. , Volkman, B.F. , Wemmer, D.E.
Primary Citation of Related Structures: 1NTR
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| NTRC RECEIVER DOMAIN | A | 124 | Salmonella Typhimurium | MQRGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALASKTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERAISHYQE |
Method: SOLUTION NMR
Deposited Date: 1994-09-16 Deposition Author(s): Amy, N.K. , Kustu, S. , Nohaile, M.J. , Volkman, B.F. , Wemmer, D.E.